<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19992
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAATTTLDEVDKELRAIITNLYMVLCQAHEYQGPNTNQALQREMKDLLQNLKNLSQKAQLLPTHVPKDIIDYVELARNPDVYTREFVELVMKYNQEQKGRNDAYGDFHDILAQTIITGIPDMAEDVKKVAAASGRPKLLVFSVRVEEVAIKHEAVERLRSIAIAALQLLQHLDAPRYTSVWENGPPTLPKVDPEAHFSIDLGPSSPSGRYVYPHSPPSVWPSHTRNRKKRSSDAQELLPPQNDSIWKKKYRPSPTEPSAERPRPSPEPLSPPSDAGRGSFVDSKEAPEAQGRRPSKVQEPRTRRGVLEPPVARRSKIRDHGV |
| Length | 322 |
| Position | Middle |
| Organism | Cercospora berteroae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.724 |
| Instability index | 51.97 |
| Isoelectric point | 8.96 |
| Molecular weight | 36242.65 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19992
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 152.04| 28| 29| 213| 240| 1
---------------------------------------------------------------------------
179- 204 (26.50/ 7.18) .....SVW...ENGPPTLPKVDPEAHfsiDLGPS
213- 240 (50.79/19.13) PHSPPSVW...PSHTRNRKKRSSDAQ...ELLPP
249- 272 (41.99/14.80) KYRPSPTE...PSAERPR....PSPE...PLSPP
283- 310 (32.77/10.26) SKEAPEAQgrrPSKVQEPRTRRG......VLEPP
---------------------------------------------------------------------------
|