Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAQTQTQSQTQTLPQEHIKAIDHLRMRLAGLSTSLHLLQQDLAKPQNDPLLAWPQLQKASTNLGQNLDGLASALSAQRQLFTSLRLHPLPNFPAHTQQGLLEQLVRKKLDPRAEAWIEESVNVGKEQSNGVAAGQESGTLTEAEMQDLWSSAMDIHQEVLAPWMEQDLFSDDFTVLERENGVKNVETGLKRDLADEDDDDEDDEDDDGDKMVEDTVKPDVVQAPAANGLNTSLPPLPLDSMLKFAHGQDVP |
Length | 251 |
Position | Head |
Organism | Cercospora berteroae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.623 |
Instability index | 43.49 |
Isoelectric point | 4.38 |
Molecular weight | 27754.48 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19990 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 128.08| 44| 60| 24| 82| 1 --------------------------------------------------------------------------- 24- 71 (68.17/64.30) LRMR.LAGLS..TSLHLLQQdLAKPQNDP.LLAWPQlqkASTNLGQNL.DGLA 84- 132 (59.92/28.45) LRLHpLPNFPahTQQGLLEQ.LVRKKLDPrAEAWIE...ESVNVGKEQsNGVA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.70| 24| 24| 167| 190| 2 --------------------------------------------------------------------------- 167- 190 (41.03/21.81) DL..FSDDFTVLERENGVKNVETGLK 192- 217 (37.67/19.54) DLadEDDDDEDDEDDDGDKMVEDTVK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KMVEDTVK 2) LKRDLA 3) MLKFAH | 210 189 241 | 217 194 246 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab