Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSAHDGERSPKRQRLDSYSPASPRPTAEPTKTFVPNYSTPPPSVRMSPSWTAQSQTSQQLQHQPGGSNFPSPPSTAGFQNRMTNRDSEHGGSGHHTPASQDDGDVRKDGDGDSEMTDRRETPGDGHRRSDHERQRGEGHNAATSSLDAVPQLYRIRTSPIVPSRPHASQNLLALYDLSAIQKRVARVDDAGNKIKLRKSYASKVKNLGLEGLNKAAPNQGELRGLVDPDWNFETAPGQTLWDQTWQESRLDDSAAENELLGKLDSALQFQPGRLPRNEHEAWKKTLGLDESTLAAKSLAASKDAKRPVPNAHLAKTAPATAMRASAPSSPRNGQRLDRAGKKRSYGDSSFEGYGEGYEDDTDLDDNGRRRDSSKRQKRKVSSSAFGSYQASGT |
Length | 393 |
Position | Head |
Organism | Cercospora berteroae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.152 |
Instability index | 60.75 |
Isoelectric point | 9.28 |
Molecular weight | 42989.40 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19986 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 102.02| 29| 31| 36| 64| 1 --------------------------------------------------------------------------- 36- 64 (54.11/28.45) NYSTPPPSVRMSPSWTAQ.SQTSQQLQHQP 68- 97 (47.91/24.34) NFPSPPSTAGFQNRMTNRdSEHGGSGHHTP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.39| 22| 33| 332| 353| 2 --------------------------------------------------------------------------- 332- 353 (40.78/20.27) NGQRLDRAGK.KRSYGDSSFEGY 366- 388 (34.61/16.28) NGRRRDSSKRqKRKVSSSAFGSY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 97.73| 33| 36| 221| 255| 3 --------------------------------------------------------------------------- 215- 253 (53.30/40.06) AApnqgELRGLVDPDWNFEtaPGQTLWD..QTWQES.RLDDS 254- 291 (44.43/26.99) AA..enELLGKLDSALQFQ..PGRLPRNehEAWKKTlGLDES --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.30| 11| 26| 106| 116| 4 --------------------------------------------------------------------------- 106- 116 (20.22/10.79) RKDGDGDSEMT 133- 143 (20.08/10.66) RQRGEGHNAAT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AHLAKTA 2) LDSYS 3) QLYRIRTSPIV 4) TAEPTKTFVPNY | 311 15 151 26 | 317 19 161 37 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab