Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MTTLDDSSHAAPALDSAPAVPSAAERDANRIRFETELEFVQCLANPFYLQSLAQQGLFEQPAFLNYLQYLRYFRDPRYARFLQYPSSLEHLSLLTAPDPAGQLFRTTLRDQPLMAQEWAGKMVARWAGWRERDVVTTGKLAAGADEDGQQRKDGAQNGEASGSGA |
Length | 165 |
Position | Middle |
Organism | Rhodotorula taiwanensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.501 |
Instability index | 47.24 |
Isoelectric point | 5.02 |
Molecular weight | 18341.20 |
Publications | PubMed=29375494 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19978 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.99| 21| 45| 26| 58| 1 --------------------------------------------------------------------------- 26- 46 (38.01/38.17) RDANRIRF...ETELEFVQCLANP 74- 97 (32.98/11.64) RDPRYARFlqyPSSLEHLSLLTAP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QQRKDGAQ 2) YLRYFR | 149 69 | 156 74 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab