<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19978
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MTTLDDSSHAAPALDSAPAVPSAAERDANRIRFETELEFVQCLANPFYLQSLAQQGLFEQPAFLNYLQYLRYFRDPRYARFLQYPSSLEHLSLLTAPDPAGQLFRTTLRDQPLMAQEWAGKMVARWAGWRERDVVTTGKLAAGADEDGQQRKDGAQNGEASGSGA |
| Length | 165 |
| Position | Middle |
| Organism | Rhodotorula taiwanensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.501 |
| Instability index | 47.24 |
| Isoelectric point | 5.02 |
| Molecular weight | 18341.20 |
| Publications | PubMed=29375494
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19978
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.99| 21| 45| 26| 58| 1
---------------------------------------------------------------------------
26- 46 (38.01/38.17) RDANRIRF...ETELEFVQCLANP
74- 97 (32.98/11.64) RDPRYARFlqyPSSLEHLSLLTAP
---------------------------------------------------------------------------
|