| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSSPSSDGSIEGDVLPPAGGELANGHGDAVPLAEPLVEGPSHSTTSATPAATNAGPLDDFDTSLFPAPPVFYHRYSDANLALPLDSVIADVPGEPKPFSRRELEPPNVEWIVEDGSYSVFGETWPVEEKTPTLAEMGVPEMFDRTHDRKVSLQTLLRTLILTYTQLLDALLAPPPSLAYPEPTLPDGRPAPTDPERLTEHMRLICFNMHYLVNELRPVQARQTLKLMMRSQIDLRRRKTIAVKQKCAEITATLASLQSDALAVAGAEPTRSRPLQPSPADAAAKAADEALDIFAKLRAKAAEA |
| Length | 303 |
| Position | Middle |
| Organism | Rhodotorula taiwanensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.285 |
| Instability index | 63.05 |
| Isoelectric point | 4.89 |
| Molecular weight | 32757.76 |
| Publications | PubMed=29375494 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19974
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 247.82| 75| 85| 48| 131| 1
---------------------------------------------------------------------------
52- 131 (130.93/55.47) TNAGPLDDFD......TSLFPAPPVFYHRYSDAnlalpLDSVIADVP..GEPKP.FSRRELEPPNVEWIVEDGSYSVFGETWPVEEKTP
134- 217 (116.89/38.76) AEMGVPEMFDrthdrkVSLQTLLRTLILTYTQL.....LDALLAPPPslAYPEPtLPDGRPAPTDPERLTEHMRLICFNMHYLVNELRP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AAAKAADEALDIFAKLRAKAAEA 2) VFYHRY | 281 70 | 303 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab