Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAVPHPPTATDIEPLTPDEIARIPSAALPISLQISHLLSEFTRLSVQLFAIISTTSPSLVAGARGSAPTDAVYDALAQIDEKLASLLGMYDAHQQRQRRIEALIGELSRLDSNWRSSALRLEACVAELDPILASGKLDRIAIDRAKEAKMTPDGLLAYARLIAPFTSAPPASLFPPEIKLKGVGATDPTGRTLPPGAIPPFPTEATMRKGRLQFGREGLLQGYLGETEQVGAGRRDSATGALLPPDPTTTAGKPADTAARLEHEAKAHAAASALTTGAVLDGAEPEAEDFVFDLDLNPDM |
Length | 300 |
Position | Middle |
Organism | Rhodotorula taiwanensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.113 |
Instability index | 42.28 |
Isoelectric point | 4.98 |
Molecular weight | 31691.66 |
Publications | PubMed=29375494 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19972 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.95| 16| 16| 73| 88| 1 --------------------------------------------------------------------------- 73- 88 (26.21/17.84) YDALAQIDEKLASLLG 90- 105 (28.73/20.18) YDAHQQRQRRIEALIG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.73| 17| 17| 239| 255| 2 --------------------------------------------------------------------------- 239- 255 (30.14/16.10) TGALLPPDPTTTAGKPA 257- 273 (26.60/13.37) TAARLEHEAKAHAAASA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.85| 17| 17| 175| 191| 3 --------------------------------------------------------------------------- 175- 191 (31.22/16.26) PP.EIKLKGVGATDPTGR 194- 211 (26.62/12.90) PPgAIPPFPTEATMRKGR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.77| 14| 21| 126| 141| 4 --------------------------------------------------------------------------- 126- 141 (18.97/17.75) AELDP..ILASGKLdrIA 148- 163 (19.80/10.72) AKMTPdgLLAYARL..IA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DFVFDLDLNP 2) LLAYARLIA | 289 155 | 298 163 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab