<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19972
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAVPHPPTATDIEPLTPDEIARIPSAALPISLQISHLLSEFTRLSVQLFAIISTTSPSLVAGARGSAPTDAVYDALAQIDEKLASLLGMYDAHQQRQRRIEALIGELSRLDSNWRSSALRLEACVAELDPILASGKLDRIAIDRAKEAKMTPDGLLAYARLIAPFTSAPPASLFPPEIKLKGVGATDPTGRTLPPGAIPPFPTEATMRKGRLQFGREGLLQGYLGETEQVGAGRRDSATGALLPPDPTTTAGKPADTAARLEHEAKAHAAASALTTGAVLDGAEPEAEDFVFDLDLNPDM |
| Length | 300 |
| Position | Middle |
| Organism | Rhodotorula taiwanensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Sporidiobolales> Sporidiobolaceae> Rhodotorula.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.113 |
| Instability index | 42.28 |
| Isoelectric point | 4.98 |
| Molecular weight | 31691.66 |
| Publications | PubMed=29375494
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19972
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.95| 16| 16| 73| 88| 1
---------------------------------------------------------------------------
73- 88 (26.21/17.84) YDALAQIDEKLASLLG
90- 105 (28.73/20.18) YDAHQQRQRRIEALIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.73| 17| 17| 239| 255| 2
---------------------------------------------------------------------------
239- 255 (30.14/16.10) TGALLPPDPTTTAGKPA
257- 273 (26.60/13.37) TAARLEHEAKAHAAASA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.85| 17| 17| 175| 191| 3
---------------------------------------------------------------------------
175- 191 (31.22/16.26) PP.EIKLKGVGATDPTGR
194- 211 (26.62/12.90) PPgAIPPFPTEATMRKGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.77| 14| 21| 126| 141| 4
---------------------------------------------------------------------------
126- 141 (18.97/17.75) AELDP..ILASGKLdrIA
148- 163 (19.80/10.72) AKMTPdgLLAYARL..IA
---------------------------------------------------------------------------
|