<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19965
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFHPQTPQSPCRFSPATTASDPNMSLSSASIATGTTLPTPAHSVNGGNSQPDALMADESPHKRKRPLDDVGDRDQKKMHLEDRKLGIEDLHLDVGDKYLLCQTLHPQSLPPTSEDLFEIFGLTDLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEEEPSDFVAMIQVPELEWNVHQVKGREVGDGLSEATLSSLGRALTMSKGPIPKTIWDTSVLGDLAPANGDASKPVSAKPTAPNTPLSSTPNVMGRSKSHLPPGHDPTRPRRNIKKRSYGDSSFEGYGEGFPDDDASMDTGYSTGEGEAGQKRRKKSSGNSPPYPAMRQQSYGPGMVGA |
| Length | 343 |
| Position | Head |
| Organism | Tolypocladium paradoxum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.814 |
| Instability index | 53.71 |
| Isoelectric point | 6.84 |
| Molecular weight | 37029.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19965
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.54| 22| 23| 51| 73| 1
---------------------------------------------------------------------------
51- 73 (35.18/22.37) QPDALMADESPHKRKRPLdDVGD
76- 97 (37.36/19.68) QKKMHLEDRKLGIEDLHL.DVGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.09| 33| 101| 104| 139| 2
---------------------------------------------------------------------------
104- 139 (48.99/39.79) TLHPQSLPPTSEDLfEIFGltDLA.AEVAREKPNGEK
210- 243 (54.10/32.70) TMSKGPIPKTIWDT.SVLG..DLApANGDASKPVSAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.54| 17| 223| 23| 43| 4
---------------------------------------------------------------------------
23- 39 (30.62/17.43) PNMSLSSASIATGTT...LP
247- 266 (27.92/ 6.70) PNTPLSSTPNVMGRSkshLP
---------------------------------------------------------------------------
|