Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHPQTPQSPCRFSPATTASDPNMSLSSASIATGTTLPTPAHSVNGGNSQPDALMADESPHKRKRPLDDVGDRDQKKMHLEDRKLGIEDLHLDVGDKYLLCQTLHPQSLPPTSEDLFEIFGLTDLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEEEPSDFVAMIQVPELEWNVHQVKGREVGDGLSEATLSSLGRALTMSKGPIPKTIWDTSVLGDLAPANGDASKPVSAKPTAPNTPLSSTPNVMGRSKSHLPPGHDPTRPRRNIKKRSYGDSSFEGYGEGFPDDDASMDTGYSTGEGEAGQKRRKKSSGNSPPYPAMRQQSYGPGMVGA |
Length | 343 |
Position | Head |
Organism | Tolypocladium paradoxum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.814 |
Instability index | 53.71 |
Isoelectric point | 6.84 |
Molecular weight | 37029.94 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19965 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.54| 22| 23| 51| 73| 1 --------------------------------------------------------------------------- 51- 73 (35.18/22.37) QPDALMADESPHKRKRPLdDVGD 76- 97 (37.36/19.68) QKKMHLEDRKLGIEDLHL.DVGD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 103.09| 33| 101| 104| 139| 2 --------------------------------------------------------------------------- 104- 139 (48.99/39.79) TLHPQSLPPTSEDLfEIFGltDLA.AEVAREKPNGEK 210- 243 (54.10/32.70) TMSKGPIPKTIWDT.SVLG..DLApANGDASKPVSAK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.54| 17| 223| 23| 43| 4 --------------------------------------------------------------------------- 23- 39 (30.62/17.43) PNMSLSSASIATGTT...LP 247- 266 (27.92/ 6.70) PNTPLSSTPNVMGRSkshLP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGQKRRKKSSG 2) EGYGEGFP 3) SPPYPAMRQQSYGP | 313 289 325 | 323 296 338 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab