<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19961
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSSQAAQDVPVASPPPPAPPAATDEEPMYGGYSRFEIELEFVQSLANPFYLNHLASQKLLTQPAFVAYLAYLRYWARPPYLKYLTYPGPTLRHLELLQEEHFRQDIMSPDLVQRLVEEEMRASVQWHREP |
Length | 130 |
Position | Middle |
Organism | Tolypocladium paradoxum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.434 |
Instability index | 83.21 |
Isoelectric point | 5.11 |
Molecular weight | 15045.92 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19961
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.00| 16| 28| 39| 54| 1
---------------------------------------------------------------------------
39- 54 (29.21/15.99) LEFVQSLANPFYLNHL
69- 84 (31.79/17.95) LAYLRYWARPPYLKYL
---------------------------------------------------------------------------
|