<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19959
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MANPNEPPLDEIQWRSPPIVAQMGGLHSNTILFYFAESPFFERTSNNAIIMSQAMNNASMYHFIQTREVFEGRLKTMSGLEFIVGEEPAETGPGMGTGVWVIRKQTRRKRYQDEDEITVHASFFVVGENIYMAPNLADILASRIMTISSAIAKALPAAESARKWRPSTGHVYHLPTNRSSSRQKSQGQASQADTPMPDGPAKSTPAPQKDGELSLERASGEAFMAHMRHGGEYFDENAITGRPGEFHLSSTGRKAVPPPKAGTESSISAMNGPTLITKFDDKKDGKADKTPKSATMPKPKRRKSKMSNGPTPAQTPTAS |
Length | 319 |
Position | Head |
Organism | Tolypocladium paradoxum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.648 |
Instability index | 53.61 |
Isoelectric point | 9.37 |
Molecular weight | 34865.00 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.51| 27| 30| 187| 215| 1
---------------------------------------------------------------------------
187- 215 (42.04/24.85) GQASQADtpMPDGPA..KSTPAPQKDGELSL
220- 248 (42.46/19.51) GEAFMAH..MRHGGEyfDENAITGRPGEFHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.22| 22| 34| 252| 274| 2
---------------------------------------------------------------------------
252- 274 (37.91/29.38) GrKAVPPPKAGT....ESSISAM.NGPT
285- 311 (31.30/18.53) G.KADKTPKSATmpkpKRRKSKMsNGPT
---------------------------------------------------------------------------
|