| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPVDRMSHEEFERTHRPPTRPPHRRAQTDPPLEQLKDVIQDFYQIMVQVSTYDTTGRPSRDVLSNEVKTLSRSLQALHASASSPHGAALPSVPPELLEYVENGRNPDIYTREFVELVRRGNQLMRGKVRAFAAFRDVLAEHLAHAMPELRADVDRVLEATGGPPLGSASSAEGGNGSTAPAARAEAASTAGG |
| Length | 193 |
| Position | Middle |
| Organism | Tolypocladium paradoxum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.552 |
| Instability index | 45.66 |
| Isoelectric point | 6.16 |
| Molecular weight | 20984.20 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19956
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.57| 29| 77| 61| 89| 1
---------------------------------------------------------------------------
61- 89 (48.43/28.76) RDVLSNEVKTLSRSLQA.....LHASASSPHGAA
136- 169 (45.14/26.36) RDVLAEHLAHAMPELRAdvdrvLEATGGPPLGSA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) APAARAEAASTAG 2) EQLKDVI 3) MAPVD | 180 34 1 | 192 40 5 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab