Description | Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
Sequence | MADQEPQEPLSLASTFPNPPPFWKDFTPDRVARIADLRSAHAERTNDAAGADASAPVRLPDLPEDLASLQPPPEPADGRWRVFGDQYMLDDRLPTLEEQGIANLPATGPSPSKEAKHYDRAFELKKLAKSLLLNFLELAGTLSRSPAAAAAKTQDLRTLFINMHHILNEYRPHQARESAMELMQDHLDRTRAETVAIRTQV |
Length | 201 |
Position | Middle |
Organism | Tolypocladium paradoxum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Tolypocladium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.589 |
Instability index | 59.28 |
Isoelectric point | 5.38 |
Molecular weight | 22393.95 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19952 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 205.07| 63| 89| 5| 69| 1 --------------------------------------------------------------------------- 5- 69 (103.70/53.42) EPQEPLSLASTFPNPPPFWKDFtpDRVARIADLRSAHAERTNDAAGADASAPVRLPDLPEDLASL 97- 159 (101.37/47.39) EEQGIANLPATGPSPSKEAKHY..DRAFELKKLAKSLLLNFLELAGTLSRSPAAAAAKTQDLRTL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GRWRVFGDQYML 2) PFWKDFTPDRVARIADLRSAHAERT | 78 21 | 89 45 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab