<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19927

Description Mediator of RNA polymerase II transcription subunit 1
SequenceMKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKDFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVSMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQTLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN
Length1555
PositionMiddle
OrganismPan paniscus (Pygmy chimpanzee) (Bonobo)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Pan.
Aromaticity0.04
Grand average of hydropathy-0.681
Instability index54.14
Isoelectric point8.79
Molecular weight165786.12
Publications
PubMed=22722832

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:Ensembl
nucleolus	GO:0005730	IEA:Ensembl
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
DNA binding	GO:0003677	IEA:Ensembl
estrogen receptor binding	GO:0030331	IEA:Ensembl
LBD domain binding	GO:0050693	IEA:Ensembl
nuclear receptor coactivator activity	GO:0030374	IEA:Ensembl
peroxisome proliferator activated receptor binding	GO:0042975	IEA:Ensembl
promoter-specific chromatin binding	GO:1990841	IEA:Ensembl
protein-containing complex binding	GO:0044877	IEA:Ensembl
retinoic acid receptor binding	GO:0042974	IEA:Ensembl
thyroid hormone receptor binding	GO:0046966	IEA:Ensembl
transcription corepressor activity	GO:0003714	IEA:Ensembl
vitamin D receptor binding	GO:0042809	IEA:Ensembl

GO - Biological Process
androgen biosynthetic process	GO:0006702	IEA:Ensembl
angiogenesis	GO:0001525	IEA:Ensembl
animal organ regeneration	GO:0031100	IEA:Ensembl
brain development	GO:0007420	IEA:Ensembl
cell morphogenesis	GO:0000902	IEA:Ensembl
cellular response to epidermal growth factor stimulus	GO:0071364	IEA:Ensembl
cellular response to hepatocyte growth factor stimulus	GO:0035729	IEA:Ensembl
cellular response to thyroid hormone stimulus	GO:0097067	IEA:Ensembl
embryonic heart tube development	GO:0035050	IEA:Ensembl
embryonic hemopoiesis	GO:0035162	IEA:Ensembl
embryonic hindlimb morphogenesis	GO:0035116	IEA:Ensembl
embryonic placenta development	GO:0001892	IEA:Ensembl
enucleate erythrocyte development	GO:0048822	IEA:Ensembl
epithelial cell proliferation involved in mammary gland duct elongation	GO:0060750	IEA:Ensembl
fat cell differentiation	GO:0045444	IEA:Ensembl
intracellular steroid hormone receptor signaling pathway	GO:0030518	IEA:Ensembl
keratinocyte differentiation	GO:0030216	IEA:Ensembl
lactation	GO:0007595	IEA:Ensembl
lens development in camera-type eye	GO:0002088	IEA:Ensembl
liver development	GO:0001889	IEA:Ensembl
mammary gland branching involved in pregnancy	GO:0060745	IEA:Ensembl
mammary gland branching involved in thelarche	GO:0060744	IEA:Ensembl
megakaryocyte development	GO:0035855	IEA:Ensembl
monocyte differentiation	GO:0030224	IEA:Ensembl
mRNA transcription by RNA polymerase II	GO:0042789	IEA:Ensembl
negative regulation of apoptotic process	GO:0043066	IEA:Ensembl
negative regulation of keratinocyte proliferation	GO:0010839	IEA:Ensembl
negative regulation of neuron differentiation	GO:0045665	IEA:Ensembl
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:Ensembl
peroxisome proliferator activated receptor signaling pathway	GO:0035357	IEA:Ensembl
positive regulation of erythrocyte differentiation	GO:0045648	IEA:Ensembl
positive regulation of G0 to G1 transition	GO:0070318	IEA:Ensembl
positive regulation of gene expression	GO:0010628	IEA:Ensembl
positive regulation of hepatocyte proliferation	GO:2000347	IEA:Ensembl
positive regulation of interferon-gamma-mediated signaling pathway	GO:0060335	IEA:Ensembl
positive regulation of intracellular estrogen receptor signaling pathway	GO:0033148	IEA:Ensembl
positive regulation of keratinocyte differentiation	GO:0045618	IEA:Ensembl
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
protein import into nucleus	GO:0006606	IEA:Ensembl
regulation of vitamin D receptor signaling pathway	GO:0070562	IEA:Ensembl
retinal pigment epithelium development	GO:0003406	IEA:Ensembl
thyroid hormone generation	GO:0006590	IEA:Ensembl
thyroid hormone mediated signaling pathway	GO:0002154	IEA:Ensembl
ventricular trabecula myocardium morphogenesis	GO:0003222	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19927
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     335.60|      49|      50|    1057|    1105|       1
---------------------------------------------------------------------------
  950-  995 (53.42/10.70)	N.GT.SN.ST......LS..G.PGLDSKPG.KR...SR..TPSND............GKSKDKPPKRKKADTEGKS
 1048- 1097 (78.79/19.24)	V.GKPSShSQ......YT..S.SGSVSSSG.SK...SHHSHSSSS............SSSASTSGKMKSSKSEGSS
 1098- 1142 (64.61/14.47)	S.SKLSS.SM......YS..S.QGSSGSSQ.SK.......NSSQS............GGKPGSSPITKHGLSSGSS
 1176- 1226 (53.07/10.58)	S.DKLAS.PM..kpvpGTppS.SKAKSPIS.SG...SGGSHMSGT............SSS...SG.MKSSSGLGSS
 1227- 1277 (46.06/ 8.22)	G.S.LSQkTPpssnscTA..S.SSSFSSSG.S.......SMSSSQ............NQHGSSKGKSPSRNKKPSL
 1342- 1408 (39.64/ 6.05)	SgSSVDS.SK......KT..SeSKNVGSTGvAKiiiSKHDGGSPSikakvtlqkpgeSSGEGLRPQMASSKNYGSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.33|      19|      25|     852|     876|       2
---------------------------------------------------------------------------
  852-  876 (26.01/23.88)	FGEEYFdessqSGDNDD..FKGfASQA
  880-  900 (31.32/12.99)	LGVPML.....GGDNGEtkFKG.NNQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     146.37|      29|      30|     301|     330|       3
---------------------------------------------------------------------------
  260-  286 (50.32/25.50)	PSF.SSITSANSVDLPACFFL.KFPQPIP
  302-  330 (54.09/32.58)	PLFETQPTYAPLYELITQFELSKDPDPIP
  333-  357 (41.96/22.36)	...HNMRFYAALPGQQHCYFLNKDA.PLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     420.13|     110|     117|     509|     625|       4
---------------------------------------------------------------------------
  515-  609 (158.88/58.91)	..................P.PAS..S.PGYGmTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGED.............F.S.KV.SQNPIL..........TSLLQITGNGGSTIGSS.PTPPHHTPPPVSSM
  610-  740 (141.77/46.14)	AGNTKNHPMLMNLLKD...nPAQdfS.TLYG....SSPL....ERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKpkhqteddfqrelF.SmDVdSQNPIFdvsmtadtldTPHITPAPSQCSTPPTTyPQPVPHPQPSIQRM
  744-  831 (119.48/37.81)	SSSDSIGPDVTDILSDiaE.EAS..KlPS...TSDDCPAIGTPLRDSSSSGHSQSTLFD..............SDV.............FqT.NN.NENPYT..........DPADLIADAAGSP..SS.DSPTNH........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.21|      39|     159|    1293|    1338|       6
---------------------------------------------------------------------------
 1293- 1331 (66.22/22.81)	PGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREK
 1454- 1492 (62.99/21.17)	PSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.49|      13|      23|     996|    1008|       7
---------------------------------------------------------------------------
  996- 1008 (27.57/12.93)	PSHSSSNRPFTPP
 1015- 1027 (25.92/11.62)	KSPGSAGRSQTPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.68|      14|      23|     425|     438|       8
---------------------------------------------------------------------------
  425-  438 (26.17/18.23)	SVSFQHPVNDSLVC
  450-  463 (23.51/15.42)	SCKLYKGLSDALIC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.17|      20|     342|    1147|    1166|       9
---------------------------------------------------------------------------
 1147- 1166 (37.32/18.35)	KPQGKPSSLMNPSLSKPNIS
 1494- 1513 (35.86/17.28)	RDKKKSHSIKPESWSKSPIS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19927 with Med1 domain of Kingdom Metazoa
Unable to open file!