<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19905
| Description |
Uncharacterized protein |
| Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPTCAFWNWIILHRNSFPVELTSILRTSTTTFKVDHGNHKV |
| Length | 216 |
| Position | Head |
| Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.388 |
| Instability index | 55.99 |
| Isoelectric point | 6.30 |
| Molecular weight | 23972.00 |
| Publications | PubMed=22722832
|
Function
| Annotated function |
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP19905
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 15| 16| 117| 132| 2
---------------------------------------------------------------------------
117- 132 (21.37/16.38) ELRNELQ.RKDALVQkH
135- 150 (24.48/14.12) KLRHWQQvLEDINVQ.H
---------------------------------------------------------------------------
|