<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19888
Description |
Uncharacterized protein |
Sequence | MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKPSGHPCVRPPHVCVCVCVCVCVFCNM |
Length | 110 |
Position | Tail |
Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
Aromaticity | 0.10 |
Grand average of hydropathy | 0.327 |
Instability index | 34.02 |
Isoelectric point | 8.91 |
Molecular weight | 12336.60 |
Publications | PubMed=22722832
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19888
No repeats found
No repeats found
|