| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNGRHRDSAGAEGTMENFTALFGAQADPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPAAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 260 |
| Position | Head |
| Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Pan. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.014 |
| Instability index | 61.58 |
| Isoelectric point | 9.86 |
| Molecular weight | 27942.56 |
| Publications | PubMed=22722832 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19882
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.16| 13| 14| 33| 45| 1
---------------------------------------------------------------------------
33- 45 (27.36/ 9.31) PPTALGFGPGKPP
49- 61 (26.99/ 9.09) PPPAGGGPGTAPP
68- 80 (25.81/ 8.40) PPGADKSGAGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.91| 16| 18| 206| 221| 3
---------------------------------------------------------------------------
186- 199 (25.73/11.94) P..PKKKNKHKHKQSR
206- 221 (27.40/13.16) PETPSDSDHKKKKKKK
225- 240 (26.77/12.70) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.59| 17| 115| 126| 146| 4
---------------------------------------------------------------------------
126- 146 (29.23/18.49) PDLPGMidlpGSHDNSSLRSL
243- 259 (34.36/13.89) PDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) MENFTALFGA | 211 18 | 245 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab