Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKITNGRHRDSAGAEGTMENFTALFGAQADPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPAAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 260 |
Position | Head |
Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Pan. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.014 |
Instability index | 61.58 |
Isoelectric point | 9.86 |
Molecular weight | 27942.56 |
Publications | PubMed=22722832 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19882 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 80.16| 13| 14| 33| 45| 1 --------------------------------------------------------------------------- 33- 45 (27.36/ 9.31) PPTALGFGPGKPP 49- 61 (26.99/ 9.09) PPPAGGGPGTAPP 68- 80 (25.81/ 8.40) PPGADKSGAGCGP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.91| 16| 18| 206| 221| 3 --------------------------------------------------------------------------- 186- 199 (25.73/11.94) P..PKKKNKHKHKQSR 206- 221 (27.40/13.16) PETPSDSDHKKKKKKK 225- 240 (26.77/12.70) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.59| 17| 115| 126| 146| 4 --------------------------------------------------------------------------- 126- 146 (29.23/18.49) PDLPGMidlpGSHDNSSLRSL 243- 259 (34.36/13.89) PDHPGM....GSSQASSSSSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) MENFTALFGA | 211 18 | 245 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab