Description | Mediator complex subunit 16 |
Sequence | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQGLLCSCGGTACSLSCRFG |
Length | 74 |
Position | Tail |
Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Pan. |
Aromaticity | 0.08 |
Grand average of hydropathy | 0.093 |
Instability index | 70.89 |
Isoelectric point | 6.50 |
Molecular weight | 8085.35 |
Publications | PubMed=22722832 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP19880 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.74| 13| 28| 30| 42| 1 --------------------------------------------------------------------------- 30- 42 (29.44/12.63) CPSVPLACAWSCR 60- 72 (28.30/11.92) CSCGGTACSLSCR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MCDLRRPA 2) SLSCRFG | 1 68 | 8 74 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab