<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19868
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIDPPHGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 180 |
| Position | Unknown |
| Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.259 |
| Instability index | 74.90 |
| Isoelectric point | 6.26 |
| Molecular weight | 18441.11 |
| Publications | PubMed=22722832
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19868
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.14| 23| 23| 42| 64| 1
---------------------------------------------------------------------------
42- 64 (53.16/11.87) PAIDP..PHGAPQ......GPPGAASGPPPP
66- 96 (37.98/ 6.10) PILRPqnPGANPQlrslllNPPPPQTGVPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.40| 14| 15| 104| 117| 2
---------------------------------------------------------------------------
104- 117 (32.06/ 9.59) QPP.GAPALLPPPHQ
121- 135 (26.34/ 6.18) QPQlGPPLLHPPPAQ
---------------------------------------------------------------------------
|