<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19866
Description |
Mediator complex subunit 25 |
Sequence | MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGHQGLLRCCLRRTRAWGSPSWGPHSCIHHLPSPGPHNFPRGLHCQVRCC |
Length | 82 |
Position | Unknown |
Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.138 |
Instability index | 54.57 |
Isoelectric point | 8.69 |
Molecular weight | 8829.05 |
Publications | PubMed=22722832
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19866
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.42| 14| 37| 29| 42| 1
---------------------------------------------------------------------------
29- 42 (31.43/15.82) GPY.F.EGHQGLLRCC
67- 82 (23.99/10.74) GPHnFpRGLHCQVRCC
---------------------------------------------------------------------------
|