<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19859
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGSVVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPSLPHCPSGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 91 |
| Position | Unknown |
| Organism | Pan paniscus (Pygmy chimpanzee) (Bonobo) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.098 |
| Instability index | 65.60 |
| Isoelectric point | 4.59 |
| Molecular weight | 9526.88 |
| Publications | PubMed=22722832
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19859
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.06| 13| 16| 47| 61| 1
---------------------------------------------------------------------------
47- 61 (20.41/16.04) FNGGP..PsLPHcPSGQ
64- 78 (22.65/ 8.48) LSGGPrgP.VPQ.PGLQ
---------------------------------------------------------------------------
|