<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19841
| Description |
Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
| Sequence | XRHGDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
| Length | 206 |
| Position | Head |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.640 |
| Instability index | 58.95 |
| Isoelectric point | 9.30 |
| Molecular weight | 21470.26 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19841
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.72| 13| 14| 21| 34| 1
---------------------------------------------------------------------------
21- 34 (23.82/ 7.48) GAQADPPPPPtALG
38- 50 (31.90/ 8.51) GKPPPPPPPP.AGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.39| 14| 38| 79| 92| 2
---------------------------------------------------------------------------
79- 92 (24.74/12.19) LMRELPGSTELTGS
120- 133 (27.66/14.42) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|
Associated diseases