<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19834
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEPQQVSALPPPPMQYIKEYTDENVRKGLAPKPPPPIRDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKRELKKLNMSILVNFLDLLDILIKSPGSIKREEKLEDLKLLFVHMHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVVEMIQGCLSSLPDDLPLPNSSSMGEAGGAAGSSRLKTEPMDVDDVAGASCMVLQTDKNVPVKKDKVCDNDAAMCRIIDEMT |
Length | 241 |
Position | Middle |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.502 |
Instability index | 46.29 |
Isoelectric point | 5.84 |
Molecular weight | 27503.63 |
Publications | PubMed=23594743
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19834
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 16| 26| 75| 92| 2
---------------------------------------------------------------------------
75- 92 (21.28/17.51) KRELKKLNMSILvnFLDL
104- 119 (26.80/15.40) KREEKLEDLKLL..FVHM
---------------------------------------------------------------------------
|