<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19824
| Description |
Mediator complex subunit 9 |
| Sequence | MASAGVAAGRQAEDALPPTSDQPLPDSKPLPPPQPPPPVAAPQPQQSPAPRPQSPARAREEENYSFLPLVHNIIKSLQ |
| Length | 78 |
| Position | Middle |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.749 |
| Instability index | 117.88 |
| Isoelectric point | 5.62 |
| Molecular weight | 8247.19 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19824
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.95| 17| 17| 17| 33| 1
---------------------------------------------------------------------------
17- 33 (35.52/10.22) PPTSDQPLPDSKPLPPP
36- 52 (35.43/10.18) PPPVAAPQPQQSPAPRP
---------------------------------------------------------------------------
|