<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19820
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYVPLYELITQFELSKDADPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGSKNPELGSG |
| Length | 556 |
| Position | Middle |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.183 |
| Instability index | 50.86 |
| Isoelectric point | 7.89 |
| Molecular weight | 61596.42 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19820
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 205.31| 48| 50| 146| 193| 2
---------------------------------------------------------------------------
146- 193 (82.98/54.79) NFDEFSKHL........KGLVNLYNL..........P..GDNKLKTKMYLALQSLEQ.DLSKMAIMYWK
196- 244 (71.32/46.06) NAGPLDKIL........HGSVG.YLT..........PrsGGHLMNLKYYVSPSDLLD.DKTASPIILHE
246- 306 (51.02/30.84) N...VSRSLgmnasvtiEGTSAMYKLpiaplimgshP..VDNKW.TPSFSSITSANSvDLP..ACFFLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.98| 17| 50| 328| 358| 3
---------------------------------------------------------------------------
336- 352 (30.05/20.28) YVPLYELITQFELSKDA
364- 380 (31.93/20.55) YAALPGQQHCYFLNKDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.16| 26| 53| 396| 424| 4
---------------------------------------------------------------------------
396- 424 (38.88/35.53) ITFQHPGRVPLIlnLIRHQVAYNTLIgSC
452- 477 (48.29/31.25) VSFQHPVNDSLV..CVVMDVQDSTHV.SC
---------------------------------------------------------------------------
|