<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19811
Description |
Mediator complex subunit 25 |
Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQILMSGGSRGPVPQPGLQPSVMEDDILMDLI |
Length | 182 |
Position | Unknown |
Organism | Callithrix jacchus (White-tufted-ear marmoset) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.223 |
Instability index | 80.58 |
Isoelectric point | 5.61 |
Molecular weight | 18789.41 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19811
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.92| 28| 44| 64| 102| 2
---------------------------------------------------------------------------
29- 57 (46.30/ 7.60) GPYFE....G....LRKHYLLPAIEYfNGGPPAETDF
67- 102 (44.62/21.33) GPILRpqnpGanpqLRSLLLNPPPPQ.TGVPPPQASL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.84| 16| 23| 140| 155| 3
---------------------------------------------------------------------------
140- 155 (31.69/10.82) PAQLPPRAP..LPGQILM
162- 179 (26.15/ 7.59) PVPQPGLQPsvMEDDILM
---------------------------------------------------------------------------
|