<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19803
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | LATAVAMETGDSGNRHRFQLELEFVQCLAILAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK |
Length | 125 |
Position | Middle |
Organism | Callithrix jacchus (White-tufted-ear marmoset) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.641 |
Instability index | 35.22 |
Isoelectric point | 8.96 |
Molecular weight | 15049.11 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19803
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.71| 22| 38| 22| 44| 1
---------------------------------------------------------------------------
22- 44 (35.50/27.33) LEFVQCLAILA..QRGYFKdKAFVN
61- 84 (38.21/24.38) LKYPQCLHMLEllQYEHFR.KELVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 25.27| 8| 21| 86| 95| 2
---------------------------------------------------------------------------
86- 95 (11.08/12.57) QCAkfIDEQQ
110- 117 (14.19/ 7.41) QQA..LAEQQ
---------------------------------------------------------------------------
|