<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19801
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPPPPGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQILMSGGSRGPVPQPGLQPSVMEDDILMDLI |
| Length | 177 |
| Position | Unknown |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.262 |
| Instability index | 83.46 |
| Isoelectric point | 6.49 |
| Molecular weight | 18075.73 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19801
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.84| 26| 44| 71| 97| 3
---------------------------------------------------------------------------
60- 91 (44.26/10.83) PPGPIL............rpqnpG.ANPQLRSLLLNPPPPQtGVP
92- 135 (40.59/ 7.35) PPQASLhhlqppgapallppphqGlGQPQLGPPLLHPPPAQ.SWP
---------------------------------------------------------------------------
|