<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19798
| Description |
Uncharacterized protein |
| Sequence | MEKELLNNGISYFLGPLLNWTLTGVIRVLLTEIHNKKYGILLFHSRYYLINGIVRYSFVAPIHLEVLRTLLDSTSCPKSVLRLSAAAILRTFPPGNSQEQRKPAQFDPLRRVAMQALGLPNEGK |
| Length | 124 |
| Position | Tail |
| Organism | Phlebia centrifuga |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Meruliaceae> Phlebia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.033 |
| Instability index | 42.48 |
| Isoelectric point | 9.93 |
| Molecular weight | 14033.32 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19798
No repeats found
No repeats found
|