<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19796
| Description |
Uncharacterized protein |
| Sequence | MSSSIAYITSKANFTQVSPDVPITKQRNPEKVDPPDVFEENKKELVTDLMVKAKQIELLIDSLPVPEPEEAQVKTLIQG |
| Length | 79 |
| Position | Middle |
| Organism | Phlebia centrifuga |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Meruliaceae> Phlebia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.405 |
| Instability index | 62.08 |
| Isoelectric point | 4.68 |
| Molecular weight | 8808.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19796
No repeats found
No repeats found
|