<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19791
| Description |
Mediator of RNA polymerase II transcription subunit like |
| Sequence | MASLASRLFDVSPNRSHWVTAFRGSLPPFLSNQTQTLTPMPPDSSPSSTKEILSLFTSLQTQLFEAVVKLQEILDLQDDYSCTTTIATQLNLSEIHLLPLPKKSSPFLHPFKLSSLKLLQNFKKFLIFKMLFEAVAKLQEILDLQDDYSCTTTIAAQLNLSDILSYAHRISYTTFAPQEFGAGQAPLRGAPPPAPQEEQLRASLLYVFAELDGLLPPNIVVPSGWRPGMPVELPSDLPIVPPPGWKLGDPVPLPPLDALPVPGRVEEPPPRPIPAPGIPKAPEPIQVQHVQLNIDDDSSDYSSDMGSSDDED |
| Length | 312 |
| Position | Middle |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.154 |
| Instability index | 75.24 |
| Isoelectric point | 4.66 |
| Molecular weight | 34231.74 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19791
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 56.03| 10| 25| 54| 63| 1
---------------------------------------------------------------------------
54- 63 (17.66/10.67) SLFTSLQTQL
81- 90 (19.80/12.67) SCTTTIATQL
149- 158 (18.57/11.52) SCTTTIAAQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.40| 17| 66| 64| 80| 2
---------------------------------------------------------------------------
64- 80 (34.20/24.84) FEAVVKLQEILDLQDDY
132- 148 (34.20/24.84) FEAVAKLQEILDLQDDY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.65| 17| 19| 216| 234| 3
---------------------------------------------------------------------------
216- 234 (33.27/17.29) PpnIVVPSGWRPGMPVELP
238- 254 (38.38/14.90) P..IVPPPGWKLGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.38| 15| 19| 95| 113| 5
---------------------------------------------------------------------------
95- 113 (19.13/19.78) IHLLPLPKKsspFLhPFKL
116- 130 (27.25/12.84) LKLLQNFKK...FL.IFKM
---------------------------------------------------------------------------
|