<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19791

Description Mediator of RNA polymerase II transcription subunit like
SequenceMASLASRLFDVSPNRSHWVTAFRGSLPPFLSNQTQTLTPMPPDSSPSSTKEILSLFTSLQTQLFEAVVKLQEILDLQDDYSCTTTIATQLNLSEIHLLPLPKKSSPFLHPFKLSSLKLLQNFKKFLIFKMLFEAVAKLQEILDLQDDYSCTTTIAAQLNLSDILSYAHRISYTTFAPQEFGAGQAPLRGAPPPAPQEEQLRASLLYVFAELDGLLPPNIVVPSGWRPGMPVELPSDLPIVPPPGWKLGDPVPLPPLDALPVPGRVEEPPPRPIPAPGIPKAPEPIQVQHVQLNIDDDSSDYSSDMGSSDDED
Length312
PositionMiddle
OrganismActinidia chinensis var. chinensis
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> Ericales> Actinidiaceae> Actinidia.
Aromaticity0.07
Grand average of hydropathy-0.154
Instability index75.24
Isoelectric point4.66
Molecular weight34231.74
Publications
PubMed=29661190

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19791
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      56.03|      10|      25|      54|      63|       1
---------------------------------------------------------------------------
   54-   63 (17.66/10.67)	SLFTSLQTQL
   81-   90 (19.80/12.67)	SCTTTIATQL
  149-  158 (18.57/11.52)	SCTTTIAAQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.40|      17|      66|      64|      80|       2
---------------------------------------------------------------------------
   64-   80 (34.20/24.84)	FEAVVKLQEILDLQDDY
  132-  148 (34.20/24.84)	FEAVAKLQEILDLQDDY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.65|      17|      19|     216|     234|       3
---------------------------------------------------------------------------
  216-  234 (33.27/17.29)	PpnIVVPSGWRPGMPVELP
  238-  254 (38.38/14.90)	P..IVPPPGWKLGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.38|      15|      19|      95|     113|       5
---------------------------------------------------------------------------
   95-  113 (19.13/19.78)	IHLLPLPKKsspFLhPFKL
  116-  130 (27.25/12.84)	LKLLQNFKK...FL.IFKM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19791 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PLDALPVPGRVEEPPPRPIPAPGIPKAPEPIQVQHVQLNIDDDSSDYSSDMGSSDDED
255
312










Molecular Recognition Features






MoRF SequenceStartStop




1) IPAPGIPKAPEPIQVQHV
273
290