<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19787
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASNQETDDSASTLSSPKNMYKDPDDGRQRFLLELEFVQCLANPIYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNSNFRNAMAHPGNKELAHRQQFYFWKNYRNNRLKHILPRPLPEPVAAPPASVPPPPPIAPTTISVSAVPPPLPASAPSPALSPMQYAIPPGSALAKNDPRNSGVDRRKRKKEV |
| Length | 206 |
| Position | Middle |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.604 |
| Instability index | 61.51 |
| Isoelectric point | 9.26 |
| Molecular weight | 23641.78 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19787
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.51| 25| 27| 129| 153| 1
---------------------------------------------------------------------------
129- 153 (50.14/17.22) ILPRPLPEPVAAP.PASVPPPPPIAP
158- 183 (44.37/14.57) VSAVPPPLPASAPsPALSPMQYAIPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.35| 20| 27| 31| 55| 2
---------------------------------------------------------------------------
31- 50 (36.40/30.52) FLLELEFVQCLANPIYIHYL
61- 80 (38.95/19.95) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.64| 13| 26| 86| 98| 3
---------------------------------------------------------------------------
86- 98 (22.09/14.86) LYFLELLQNSNFR
115- 127 (25.54/18.21) FYFWKNYRNNRLK
---------------------------------------------------------------------------
|