<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19761
| Description |
Mediator of RNA polymerase II transcription subunit 15a like |
| Sequence | MDDDTNMAGGDKPTMDTGDWRAQLQPDSRQRIVNKIMDTLKRHLPFSGEEGLQELKKIAARFEEKTYTSSTSQPDYLRKISLKMMTMENKSQNTTANSLLSSSANNSENPTDSDNIMLHNGNLGIEKLHL |
| Length | 130 |
| Position | Tail |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.937 |
| Instability index | 46.37 |
| Isoelectric point | 5.58 |
| Molecular weight | 14632.20 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19761
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.15| 19| 20| 40| 58| 1
---------------------------------------------------------------------------
40- 58 (31.19/22.05) LKRHLPFSGEEGLQELKKI
62- 80 (31.96/22.75) FEEKTYTSSTSQPDYLRKI
---------------------------------------------------------------------------
|