Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAATPNTAAGNPNFEGNPPAAPPPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWSCNNEQLRTRAIHPLDISHLSKMKGTEYILSEVMEPHLFVFRMQKRDSPEKVTAMLTYYVMDGSIYQAPQLCNVFAARVGRALYHISKAFTTAASKLEKIGYVDSDSESAAIESKVGKETIDLKEIKRIDLILASLQRKLPPAPPPPPFPEGYAPPPTADGENGSEAPPATESQVPSVDPIIDQGPPKRMKI |
Length | 254 |
Position | Head |
Organism | Actinidia chinensis var. chinensis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> Ericales> Actinidiaceae> Actinidia. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.386 |
Instability index | 56.77 |
Isoelectric point | 5.45 |
Molecular weight | 28034.67 |
Publications | PubMed=29661190 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19756 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.26| 15| 21| 205| 222| 2 --------------------------------------------------------------------------- 205- 222 (27.10/18.06) APPPppfPEGYAP..PPTAD 229- 245 (24.16/ 8.19) APPA...TESQVPsvDPIID --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IIDQGPPKRMKI 2) LILASLQRK | 243 193 | 254 201 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab