<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19754
| Description |
Mediator of RNA polymerase II transcription subunit 19a like |
| Sequence | MDPEGKKFGRGPRELTGAADLISHYKLLSHHEFFCKRSLPLSISDTHYLHNVVGDTEVRKGEGMQLDQLIQDMSYSREANARIQPFDLNVLSEAFQLRETTQIDLPPAEKGIPTIAGKSKSKSKDKVRKHKRHKDKDREKDRDDKKHKHRHKDRSKDNDKEKKKDKSGHQDSGAEHLKKHHEKKRKHDGDENLTDIHSHKKSKLKSTKIEETGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.398 |
| Instability index | 35.21 |
| Isoelectric point | 9.59 |
| Molecular weight | 25182.08 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19754
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.51| 14| 15| 128| 142| 1
---------------------------------------------------------------------------
128- 142 (22.93/11.45) RKHKrHKDKDREKDR
145- 158 (27.58/10.45) KKHK.HRHKDRSKDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.12| 14| 15| 173| 186| 2
---------------------------------------------------------------------------
173- 186 (25.81/12.48) GAEHLKK.HHEKKRK
189- 203 (21.31/ 9.08) GDENLTDiHSHKKSK
---------------------------------------------------------------------------
|