<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19742
| Description |
Mediator of RNA polymerase II transcription subunit 19a like |
| Sequence | MDPEGRKFGRGPRELTGAVDLINHYKLLPHHEFFCKRALPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQDASYSREASVRIRPFDLDVLTEAFQLRETAPIDLPAAEKGIPTIAGKSKNESKDKERKHKKHKDKEHKKHRHRHKDRSKDKDKDKEKKKDKSGHHDSGTEHTKKHHDKKRKHDGDEDLNDVHSHKRSKHKSSKIDEIGGTIKVAG |
| Length | 216 |
| Position | Head |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.400 |
| Instability index | 38.05 |
| Isoelectric point | 9.50 |
| Molecular weight | 24857.65 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19742
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.60| 16| 18| 132| 147| 1
---------------------------------------------------------------------------
132- 147 (30.79/11.14) KHKDKEHKKHRHRHKD
152- 167 (27.49/ 9.16) KDKDKEKKKDKSGHHD
171- 186 (25.33/ 7.87) EHTKKHHDKKRKHDGD
---------------------------------------------------------------------------
|