<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19735
| Description |
Serine/threonine-protein kinase |
| Sequence | MSQQENHVMEHLCIALEGRSSLEMTVANSNQMIRELEQNMDSAVEQLEKYKKERDELQLERDDALKLAEEMRKKQEDTLNTLMPLYFSLSEIDQSLKIGEGGYRGFLRHTQVAIKMLDSQSLQGPSEFQQEVNFLIKLRHPNIVNLIGTCPEAFILVYECLPSGSLEDRLSCVDRTPPLSWQTQIRIAAELCAVLIFLHSCKPDSIVHGDLKPGNILLDANYVCKLGDFGIGRAITQNELSSNDTTLCRRTDPKGTFAYIDPEFVATGELTTKSDVYSFGIILLRLLTGRPAVGLPADVQNALTNKNLEDLLDDTAGDWPFVLAEQLACLALRCCETNRRGRPDLASDVWRVLEPMTISCGAPSFTVSPEEHRQIPSYFVCPILQDIMEDPHIAADGYTYELEALRGWLDSGHDTSPMTNVQLPNLIVVPNRALRSAIQEWLQNR |
| Length | 445 |
| Position | Tail |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.247 |
| Instability index | 46.97 |
| Isoelectric point | 4.83 |
| Molecular weight | 50008.45 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
Functions as an E3 ubiquitin ligase.
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
ubiquitin-protein transferase activity GO:0004842 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19735
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.54| 21| 293| 83| 103| 1
---------------------------------------------------------------------------
83- 103 (38.64/24.90) MPLYF...SLSEIDQSLKIGEGGY
375- 398 (34.90/21.88) IPSYFvcpILQDIMEDPHIAADGY
---------------------------------------------------------------------------
|