<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19724
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNVPHQIVPSPARLGLPNPNSPSVQNPTAPKFSSQLPQSHVPNQQSTLSTFTTTSSTLLPLLPPLSRAQSLLLQMASLASRLFDVSPNRSHWISAFRGSLPTFLSSQTQTLAPTPPDASPSSTKEIISLFTSLQTQLFEAVAELQEILDLQDAKQKLTREIRSKDTAMLSFANKLKETERVLDILVDDYSDYRRLKRSKSDDNADDSCTTTIATQLNLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQLRASQLYAFAELDVGLPKSVESKEKTMEPFIEAPPAQPAELNPLANLTAIQGLLPPNIVVPSGWKPGMPVELPSDLPIVPPPGWKPGDPVPLPPLDVLPVPGRAEEQPPRPIPAPGMPKAPEPMQVRHVQLDIDDDSSDYSSDMGSSDDED |
| Length | 410 |
| Position | Middle |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.391 |
| Instability index | 75.24 |
| Isoelectric point | 4.78 |
| Molecular weight | 44566.89 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.38| 17| 19| 314| 332| 1
---------------------------------------------------------------------------
314- 332 (34.81/19.53) PpnIVVPSGWKPGMPVELP
336- 352 (40.57/17.57) P..IVPPPGWKPGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.54| 29| 50| 34| 66| 2
---------------------------------------------------------------------------
18- 35 (31.51/ 7.90) LPN...PNSPSVQN..........PTAPKFS
38- 68 (43.95/23.73) LPQshVPNQQSTLSTFTTTSSTLLPLLPPLS
95- 118 (26.08/ 6.70) .....ISAFRGSLPTFLSSQTQTLAPTPP..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.99| 29| 32| 125| 154| 3
---------------------------------------------------------------------------
125- 154 (41.61/30.11) TKEIISLFTSLQTqLFEAVAELQEILD.LQD
160- 189 (42.38/26.02) TREIRSKDTAMLS.FANKLKETERVLDiLVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.28| 12| 53| 236| 247| 5
---------------------------------------------------------------------------
236- 247 (23.44/10.02) APPEFGAGQAPL
292- 303 (21.83/ 8.86) APPAQPAELNPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.52| 16| 123| 249| 265| 6
---------------------------------------------------------------------------
249- 265 (26.67/14.95) GaLPPAPQEEQLRASQL
375- 390 (30.85/13.80) G.MPKAPEPMQVRHVQL
---------------------------------------------------------------------------
|