<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19722
Description |
Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MDHSFGGGSWSMIPNIPVHSNPTTPSNQDHLYLQQQQQQQQQFHHHHQQQQQLLHQQQQQQQQFHPQQQQFHHQQFQPHQQQLPPPPPQQRHQQQQQQSQQQHHHHQSLASHFHLLHLVENLSDSIENGTRDQHSDALVTELTNQFEKCQQLLNSISGSINAKAMTVEGQKRKLEECEQLLNQRKDLIAKYRNSVEELINSDP |
Length | 203 |
Position | Middle |
Organism | Actinidia chinensis var. chinensis |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.336 |
Instability index | 68.33 |
Isoelectric point | 6.37 |
Molecular weight | 23905.84 |
Publications | PubMed=29661190
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19722
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.88| 18| 18| 55| 72| 2
---------------------------------------------------------------------------
55- 72 (40.09/11.27) HQQ.QQQQQQF.HPQQ..QQFH
73- 92 (30.05/ 6.31) HQQfQPHQQQLpPPPP..QQRH
95- 114 (31.74/ 7.14) QQQ.QSQQQHH.HHQSlaSHFH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.20| 18| 27| 137| 154| 3
---------------------------------------------------------------------------
137- 154 (31.46/18.57) AL.VTELTNQFEKCQQLLN
164- 182 (26.74/14.87) AMtVEGQKRKLEECEQLLN
---------------------------------------------------------------------------
|