<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19717
| Description |
Mediator of RNA polymerase II transcription subunit 19a like |
| Sequence | MQLDQLIQDMSYSRGTNARIQPFDLNVLSEAFQLRDTTQIDLPPAEKGVPTVAGKSKSKSKDKERKHKKHKDKDREKDKDDKKHKHRHKDRSKDKDKEKKKDKSGHQDSGAENLKKHHEKKRKHDGDENLTDIHSHKKSKHKSTKTEETGAIKVAG |
| Length | 156 |
| Position | Head |
| Organism | Actinidia chinensis var. chinensis |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> Ericales> Actinidiaceae> Actinidia.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -1.829 |
| Instability index | 34.61 |
| Isoelectric point | 9.75 |
| Molecular weight | 18013.98 |
| Publications | PubMed=29661190
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19717
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.58| 15| 15| 69| 83| 1
---------------------------------------------------------------------------
69- 83 (26.96/ 8.03) KHKDKDREKDKDDKK
85- 99 (26.63/ 7.85) KHRHKDRSKDKDKEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.97| 15| 15| 110| 124| 2
---------------------------------------------------------------------------
110- 124 (29.26/12.44) GAENLKK.HHEKKRKH
126- 141 (24.71/ 9.54) GDENLTDiHSHKKSKH
---------------------------------------------------------------------------
|