| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSGHLLLPTLAGRVSLNRRSDRRENGFSTSLGLKGASVCLPLVVDLDDHLDTIDSEQTMELNDLHPPDDYSHRFFIWHEWIQANGPLTNENVFDYFATSMFYDKQSNNQVLRMQTMHTGEPLLNEAEELRRFTGIEFAVVHSQPPSLFIIHKRERLSADEEPTEDRTQLTSLHSLQTSLDTLRSHRPAYTPRTGFIWPIKEAPASEDSKKRSLEEVTDETQPPQPPEGLVDSSQKRKLTVTLGHKKRQNNVLLVNAMRTTAVHSTKSFSIPTALSESVVADTPASATAGRSSATPAPITQRGATPKLPPGSTAPQETASAKGPLIGGKKKKKREYL |
| Length | 336 |
| Position | Head |
| Organism | Phlebia centrifuga |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Meruliaceae> Phlebia. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.629 |
| Instability index | 54.41 |
| Isoelectric point | 6.88 |
| Molecular weight | 37336.53 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19696
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.19| 30| 79| 199| 228| 1
---------------------------------------------------------------------------
199- 228 (51.77/31.96) IKEAPASEDSKKRSL..EEVTDETQPPQPPEG
279- 310 (46.42/27.91) VADTPASATAGRSSAtpAPITQRGATPKLPPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.43| 27| 117| 49| 77| 2
---------------------------------------------------------------------------
49- 77 (45.77/36.93) HLDTIDSEQTmELNDL..HPPdDYSHRF.FIW
168- 197 (41.66/24.50) QLTSLHSLQT.SLDTLrsHRP.AYTPRTgFIW
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GFIWPIK 2) TAPQETASAKGPLIGGKKKKKREYL 3) TQRGATPKL | 194 312 299 | 200 336 307 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab