<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19692
| Description |
Uncharacterized protein |
| Sequence | MFQQEHVDLKTQKPIPAHGDTLWEVEVKTASPVRNTQDTPLSQSIEAVLEVQLLMKGLLDLRRQDV |
| Length | 66 |
| Position | Head |
| Organism | Phlebia centrifuga |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Meruliaceae> Phlebia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.423 |
| Instability index | 51.23 |
| Isoelectric point | 5.13 |
| Molecular weight | 7522.53 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19692
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.06| 15| 16| 7| 21| 1
---------------------------------------------------------------------------
7- 21 (27.47/20.07) VDLKTQKPIPAHGDT
25- 39 (25.59/18.33) VEVKTASPVRNTQDT
---------------------------------------------------------------------------
|