<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19691
| Description |
Uncharacterized protein |
| Sequence | MAAPHFYEVALFGEFFTKDLSAILNRITLHSESAHQMHARELLFEPFDAQHQRDTGNDPVLLRARKELLEPDAKWVLFSYLKPESVRVHPEATVRPWATCQVVGDALSFASALGYV |
| Length | 116 |
| Position | Head |
| Organism | Phlebia centrifuga |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Meruliaceae> Phlebia.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.116 |
| Instability index | 28.04 |
| Isoelectric point | 5.81 |
| Molecular weight | 13165.84 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19691
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.15| 13| 22| 37| 50| 1
---------------------------------------------------------------------------
37- 50 (20.52/19.07) MHARELLFEPfDAQ
62- 74 (22.63/14.75) LRARKELLEP.DAK
---------------------------------------------------------------------------
|