Description | Mediator of RNA polymerase II transcription subunit 16 |
Sequence | MNECCLLPNQVMIPQLNPPTKIVAVASPALFYQSLPIQLNPVEGAMQTEQTVDSIRHIYLGKQPLVVKQCCRCGCKAQVQSMTRTAAIRAWDQRWARACRCGGHWRIHKFL |
Length | 111 |
Position | Tail |
Organism | Blattella germanica (German cockroach) (Blatta germanica) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae> Blattellinae> Blattella. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.103 |
Instability index | 60.48 |
Isoelectric point | 9.38 |
Molecular weight | 12562.73 |
Publications | PubMed=29403074 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP19681 No repeats found |
MoRF Sequence | Start | Stop |
1) IRAWD 2) IRHIYL | 88 55 | 92 60 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab