<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19681
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MNECCLLPNQVMIPQLNPPTKIVAVASPALFYQSLPIQLNPVEGAMQTEQTVDSIRHIYLGKQPLVVKQCCRCGCKAQVQSMTRTAAIRAWDQRWARACRCGGHWRIHKFL |
| Length | 111 |
| Position | Tail |
| Organism | Blattella germanica (German cockroach) (Blatta germanica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae>
Blattellinae> Blattella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.103 |
| Instability index | 60.48 |
| Isoelectric point | 9.38 |
| Molecular weight | 12562.73 |
| Publications | PubMed=29403074
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19681
No repeats found
|