| Description | Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MNECCLLPNQVMIPQLNPPTKIVAVASPALFYQSLPIQLNPVEGAMQTEQTVDSIRHIYLGKQPLVVKQCCRCGCKAQVQSMTRTAAIRAWDQRWARACRCGGHWRIHKFL |
| Length | 111 |
| Position | Tail |
| Organism | Blattella germanica (German cockroach) (Blatta germanica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae> Blattellinae> Blattella. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.103 |
| Instability index | 60.48 |
| Isoelectric point | 9.38 |
| Molecular weight | 12562.73 |
| Publications | PubMed=29403074 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP19681 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IRAWD 2) IRHIYL | 88 55 | 92 60 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab