<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19680

Description Cyclin-dependent kinase 8
SequenceMMDYEFKLKTASERAKVEDLFDYEGCKVGRGTYGHVYKARRKDGSDTRDYALKQIEGTGLSMSACREIALLRELKHSNVINLIRVFLSHNDRKVWLLFDYAEHDLWHIIKFHRAAKANKKPVMVPKGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPLEKDWEDIKKMPEHPTLLKDFKRANYSNCSLVKYMDRHKIKPDSKAFHLLQKLLLMDPTKRITSEQAMQDAYFQEEPLPTQDVFAGCQIPYPKREFLTDDDNEDKSENKARQNQPQNGNQGGQGDQGNHNHNHGPNAKRVRLAPPHPVSTSSGMTSQQQQQQQQPEFHHVQQQQQSHVSQPGMIFTSTANTQPTPNFAQRF
Length464
PositionKinase
OrganismBlattella germanica (German cockroach) (Blatta germanica)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae> Blattellinae> Blattella.
Aromaticity0.09
Grand average of hydropathy-0.684
Instability index43.88
Isoelectric point8.77
Molecular weight53531.35
Publications
PubMed=29403074

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP19680
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     123.54|      31|      35|     136|     166|       1
---------------------------------------------------------------------------
  103-  128 (25.64/12.38)	.........HDLWhiiKFH..RAAKANKKPVMVPKGM
  136-  166 (57.32/36.09)	ILD.GIHYLHSNW...VLH..RDLKPANILVMGEGPE
  172-  204 (40.57/23.55)	IADmGFARLF.NA...PLKplADLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     142.11|      29|      29|     402|     430|       2
---------------------------------------------------------------------------
  372-  400 (44.79/20.51)	KARQNQPQN.GNQGGQGDQgNHNHNHGPNA
  402-  430 (48.04/22.42)	RVRLAPPHPVSTSSGMTSQ.QQQQQQQPEF
  432-  460 (49.27/23.14)	HVQQQQQSHVSQPGMIFTS.TANTQPTPNF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.26|      16|      20|     308|     325|       4
---------------------------------------------------------------------------
  308-  325 (21.65/20.73)	KAFH..LLQKLLLmdPTKRI
  329-  346 (24.61/15.18)	QAMQdaYFQEEPL..PTQDV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP19680 with CDK8 domain of Kingdom Metazoa

Unable to open file!