Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MMPGRTACLPENPLGLSWHDSAWIPMLNPTNIMDYFSERSNPFFDRTCNNEIVKMQRLNPEQLNNMTGLEYILLHVQEPILYVIRKQHRHSPTQATPLADYYIIAGIVYQAPDLISVVNSRLISAVHHLQSAFEEANSYSRYHPSKGYSWDLKERKVPERAAKKETQREEPSSLFQRHRVDMLLAELTRKFPIPIVVPPQVAKPPPTNDEVKQEPREVKNEKPDTPRNMKPPPEKKPRLA |
Length | 240 |
Position | Head |
Organism | Blattella germanica (German cockroach) (Blatta germanica) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae> Blattellinae> Blattella. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.712 |
Instability index | 46.34 |
Isoelectric point | 8.97 |
Molecular weight | 27793.57 |
Publications | PubMed=29403074 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19678 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 94.27| 29| 32| 52| 81| 1 --------------------------------------------------------------------------- 52- 81 (46.70/34.96) IVKMQRLNPEQLNNMTGLeYILLHV..QEPIL 84- 114 (47.57/30.91) IRKQHRHSPTQATPLADY.YIIAGIvyQAPDL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 105.62| 33| 37| 134| 170| 2 --------------------------------------------------------------------------- 137- 170 (54.44/32.59) NSYSRYHPSKGYSWDLkERK......VPERAAKKETQREE 172- 210 (51.18/21.37) SSLFQRHRVDMLLAEL.TRKfpipivVPPQVAKPPPTNDE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LTRKFPIPIVVPPQVAK 2) PTNDEVKQEPREVKNEKPDTPRNMKPPPEKKPRLA | 187 206 | 203 240 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab