<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19677
| Description |
Uncharacterized protein |
| Sequence | MKHSPLEMMKEKLLKALDKEYNVVDMGTVVEIITILERTPITKEALEETNNHLLDIVLLPNTEETIYKQCDLSQNQRRRRRRKKYLRKKKKKKKKKSIFVDHKK |
| Length | 104 |
| Position | Unknown |
| Organism | Blattella germanica (German cockroach) (Blatta germanica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae>
Blattellinae> Blattella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.978 |
| Instability index | 54.49 |
| Isoelectric point | 9.96 |
| Molecular weight | 12532.75 |
| Publications | PubMed=29403074
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19677
No repeats found
|