<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19676
Description |
Uncharacterized protein (Fragment) |
Sequence | VSHLKKYIKEIGQKTKDDRLKKRAKDLVRRWHDMVEEHSSVLTNAASIFQGDSINDQNLHSGPVSHQVSEPLVHPVLRSSARLRSRASTSPGGVMMSSSSIGITSSSNIQRKRSPRVSSVHGKKMSCHEVQTTTTGNTFAQMATATAVKTDAVPRTCGSFKKPRKRSQRVDSKEMSFTPSKPDVQCERAVTRSAGVIKAKVTTATPKVMNVDKSVCDPVAMASATDSITTTNPGTSTNVPKGMFTAQCVNVPNFALTSDNTASNAPEPATRVSPVDFAMLPSKQILPGCTSDYLTELQAFKERTSRMRTTKQLAAFVQRKGRPSASKGNLKESPSDVAKFKEEHIKRYIATQSKYCHMGEDPEEAKQEILSKLPPLDVGVICWSRDEFKPPKEVTEELVTMLHTEHLDGINGTFNVGAKPGEVGEFREWNEEVSKVSYNGELLQIAPYVLLE |
Length | 452 |
Position | Unknown |
Organism | Blattella germanica (German cockroach) (Blatta germanica) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae>
Blattellinae> Blattella.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.564 |
Instability index | 50.07 |
Isoelectric point | 9.37 |
Molecular weight | 49660.88 |
Publications | PubMed=29403074
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19676
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.07| 13| 52| 111| 126| 1
---------------------------------------------------------------------------
111- 126 (20.04/22.97) RKRSPRVSSvhgKKMS
164- 176 (25.03/16.70) RKRSQRVDS...KEMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.46| 13| 100| 134| 148| 3
---------------------------------------------------------------------------
134- 146 (22.70/ 7.22) TTGNTFAQMATAT
235- 247 (20.76/11.88) TSTNVPKGMFTAQ
---------------------------------------------------------------------------
|