<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19673
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNENDLFAADTVFKNIKKIMYPMYNLSIRDNITSYLSSLTSVRWRYLTLTPGAQKFKLPTLDNASLFLTLDSDLARNRSALFLRHGYMWSMDNIIISPKSKNKQMNGSLELQKKVILKILDGMPRVRSFSDMSYHCHRSIVFSDQEGKIELIFNNVQTQPALMKMTFGDSRNCEDFLSPMYIVYVYIFFMYLFVFLMMLKLLNNIQVHKDFEDPNKPYLTANLLTFIIHQTMQREEKQLDASLEAIIIRVNDLKNSIGSMLVKLEHEYETLNWPTFLDNFALMSGHLTSLSKLLSHDKSPPLRNLTVLPLLLSPDRDEELLRLTEGRVPTFSHDLVPDYLRTKPEPDKQVTAYSKVVNHVWDIVSKAREEWETETGSRSGAAQTSSMSDTHTLVAAVGMGKGLKPMQQPVPSGPQSMMVAPVGRPGAGPQQPGAGPMNPNQPGQMGPMGKAPSAIKTNIKAASQIHPYGR |
| Length | 470 |
| Position | Head |
| Organism | Blattella germanica (German cockroach) (Blatta germanica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae>
Blattellinae> Blattella.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.280 |
| Instability index | 45.30 |
| Isoelectric point | 8.99 |
| Molecular weight | 53150.91 |
| Publications | PubMed=29403074
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19673
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.17| 17| 17| 293| 309| 3
---------------------------------------------------------------------------
289- 306 (25.97/13.13) SLSkLLSHDKSPPLRNLT
307- 324 (25.20/12.55) VLPlLLSPDRDEELLRLT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.41| 17| 19| 205| 223| 4
---------------------------------------------------------------------------
205- 223 (20.99/26.21) IqVHKDFEDPNKPyLTANL
227- 243 (28.42/20.29) I.IHQTMQREEKQ.LDASL
---------------------------------------------------------------------------
|