<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19671
| Description |
Uncharacterized protein |
| Sequence | MVLNKPCINNNSNAKMAATTNGNGNLVDEFEEAFQSCLTVLTKEEALPTMEKDEIRVEVDHTILRFIDLARQMEAFFLQKRFLLSALKPELVVKEGPPGISVASGSGGPGPMVSPQQAMFMQQSGSPRGPPGFPTQGPGGVLQGPLAFLEKTTSNIGMPEGRR |
| Length | 163 |
| Position | Head |
| Organism | Blattella germanica (German cockroach) (Blatta germanica) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae>
Blattellinae> Blattella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.260 |
| Instability index | 52.57 |
| Isoelectric point | 5.48 |
| Molecular weight | 17529.95 |
| Publications | PubMed=29403074
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19671
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.68| 24| 31| 96| 126| 1
---------------------------------------------------------------------------
96- 126 (34.83/31.79) GPPGISvASGSGG..PGPMvspqqAmFMQQSGS
129- 154 (44.84/20.94) GPPGFP.TQGPGGvlQGPL.....A.FLEKTTS
---------------------------------------------------------------------------
|