<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19667
Description |
Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MNLPPMQQPGPGVMPQVQQQPGPGTPQQAQQMQQPMPQQQQEKLDNISKVKSLITPLRESLAVTLKNAAATLQQNNLKTSIECLSQGAASQRYLPLQVALTRTDPMPGQEILTYPQYLATVRAQVGFAKEVHDMLVGAAQNVSPGE |
Length | 146 |
Position | Tail |
Organism | Blattella germanica (German cockroach) (Blatta germanica) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Polyneoptera> Dictyoptera> Blattodea> Blaberoidea> Ectobiidae>
Blattellinae> Blattella.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.484 |
Instability index | 62.87 |
Isoelectric point | 7.87 |
Molecular weight | 15867.03 |
Publications | PubMed=29403074
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19667
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.63| 12| 19| 4| 20| 1
---------------------------------------------------------------------------
4- 20 (19.40/14.93) PP....MQQPgpgvMPQvQQQ
26- 41 (23.22/ 6.45) PQqaqqMQQP....MPQ.QQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.37| 13| 18| 57| 70| 2
---------------------------------------------------------------------------
57- 70 (15.46/17.51) LRESLAvTLKNAAA
77- 89 (21.91/18.11) LKTSIE.CLSQGAA
---------------------------------------------------------------------------
|