<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19648
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MFTAAMVFLPLVTFFTVQYLFSGNPLVSGGSAAVAANGVLIAYIVVAFSEDTSDESSEKSEPKKDIYKDIAQKKEGSQGGDAPQAKDNESDLMEIDPEDASKSTESKATTNNDAQPQDAVKEEEEQPIDIKDSFLQFLEELGYDVVNQYWSKGIRFFHGDIVIEIFKIFVRDDDPEASSADLGIKLKLLDESNTFQIKAFINYPKGTSVDLINQGTKSLVKIKELLHNLFELDVPDRMFMDARVNRNK |
| Length | 248 |
| Position | Head |
| Organism | [Candida] pseudohaemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.361 |
| Instability index | 31.87 |
| Isoelectric point | 4.49 |
| Molecular weight | 27638.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | cytoplasmic vesicle GO:0031410 IEA:UniProtKB-KW
integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
vacuolar proton-transporting V-type ATPase complex assembly GO:0070072 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.59| 29| 31| 54| 84| 1
---------------------------------------------------------------------------
54- 84 (45.61/40.42) DESSEKSE.PKKDIYKDIAQKkeGSQGGDA.PQ
87- 117 (40.98/29.15) DNESDLMEiDPEDASKSTESK..ATTNNDAqPQ
---------------------------------------------------------------------------
|